Subject: FASTA program discussion list
List archive
- From: John Wise <>
- To: Helena Storvall <>
- Cc: Georgios Magklaras <>, "" <>
- Subject: Re: [admin] segmentation fault
- Date: Thu, 31 Oct 2013 11:38:57 -0500
I am curious about the following
Query: /tmp/50438.seq1
1>>>seq1 - 342 aa
Library: /tmp/50438.seq2
44997 residues in 1 sequences
1>>>seq1 - 342 aa
Library: /tmp/50438.seq2
44997 residues in 1 sequences
is 50438.seq2 really 44997 residues? Or is something odd happening there?
john
John Wise
University of Nebraska-Lincoln
345 Food Industry Complex
Lincoln, NE 68583-0919
402-770-2705
University of Nebraska-Lincoln
345 Food Industry Complex
Lincoln, NE 68583-0919
402-770-2705
On Thu, Oct 31, 2013 at 10:53 AM, Helena Storvall <> wrote:
Hi Georgios,
Thanks for your reply.
No, there is no pasa_killer.input file unfortunately.
Is there any other info I could give that would help?
Best regards,
Helena
________________________________________
From: Georgios Magklaras []
Sent: Thursday, October 31, 2013 4:44 PM
To:
Cc: Helena Storvall
Subject: Re: [admin] segmentation fault
On 31/10/13 15:25, wrote:
> Hi,
> I am running into a problem with segmentation fault while using fasta through
> another program (PASA, http://pasa.sourceforge.net).
>
> Here is the command and the error message:
> fasta /tmp/50438.seq1 /tmp/50438.seq2 > /tmp/50438.grasta_result
> Segmentation fault
>
> The server I'm running on:
> Linux rna 3.0.0 #1 SMP Thu Aug 4 15:10:31 CEST 2011 x86_64 Intel(R) Xeon(R) CPU
> X7550 @ 2.00GHz GenuineIntel GNU/Linux
>
> Fasta version: version 36.3.6 Sep, 2013(preload9)
>
> Below is what the three files look like.
>
> 1. /tmp/50438.seq1:
>> seq1
> MNGPVDYIQEHTLKDVGAFMFTSESVGEGHPDKICDQISDAVLDAHLSQDPDAKVACETV
> CKTGMVLLCGEITSRAVVDYQKIVRDTIKYIGYDDSEKGFDYKTCNVLVALEQQSPDIAQ
> GVHLDRQEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGVLPWLRPD
> SKTQVTVKYIQKNGAVIPVRVHTIVISVQHDETISLSDMQDALKEQVIKAVVPEKYLDEK
> TVYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAAR
> WVAKSLVHAKLCHRVLVQVHLIWVFMKQIKLHISKHIVRDW*
>
> 2. /tmp/50438.seq2:
>> seq2
> MVLLCGEITSRAVVDYQKIVRDTIKYIGYDDSEKGFDYKTCNVLVALEQQSPDIAQGVHL
> DRQEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGVLPWLRPDSKTQ
> VTVKYIQKNGAVIPVRVHTIVISVQHDETISLSDMQDALKEQVIKAVVPEKYLDEKTVYH
> LQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARWVAK
> SLVHAKLCHRVLVQVHLIWVFMKQIKLHISKHIVRDW*
>
>
> 3. /tmp/50438.grasta_result:
> # fasta /tmp/50438.seq1 /tmp/50438.seq2
> FASTA searches a protein or DNA sequence data bank
> version 36.3.6 Sep, 2013(preload9)
> Please cite:
> W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
>
> Query: /tmp/50438.seq1
> 1>>>seq1 - 342 aa
> Library: /tmp/50438.seq2
> 44997 residues in 1 sequences
>
> Statistics: Altschul/Gish params: n0: 342 Lambda: 0.158 K: 0.019 H: 0.100
> statistics sampled from 0 (1) to 0 sequences
> Algorithm: FASTA (3.8 Nov 2011) [optimized]
> Parameters: BL50 matrix (15:-5), open/ext: -10/-2
> ktup: 2, E-join: 1 (0.5), E-opt: 0.2 (0.5), width: 16
> Scan time: 0.040
>
> The best scores are: opt bits E(2)
> seq2 (44997) 1854 429.0 2.2e-122
> seq2 (44997) 0 6.9 2
>
>
> Could someone explain why I get a segmentation fault? And how to get around it
> so I can continue the PASA run?
>
> Best regards,
> Helena
>
> Helena Storvall
> PhD student
> Sandberg lab
> Karolinska Institutet
> Stockholm, Sweden
> email:
>
Hei,
There could be a number of different reasons why the PASA pipeline
segfaults and one needs more info.
1)On the working directory is there a pasa_killer.input file after the
crash?
2)If yes, then could you do a: pasa pasa_killer.input and post here the
output?
GM
Best regards,
--
--
George Magklaras PhD
RHCE no: 110-320-413
Head of IT/Senior Systems Engineer
Biotechnology Center of Oslo and
the Norwegian Center for Molecular Medicine/
Vitenskapelig Databehandling (VD) -
Research Computing Services - USIT
EMBnet TMPC Chair
http://folk.uio.no/georgios
http://www.uio.no/english/services/it/research/hpc/abel/
Tel: +47 22840535
- segmentation fault, helena.storvall, 10/31/2013
- Re: [admin] segmentation fault, Georgios Magklaras, 10/31/2013
- RE: [admin] segmentation fault, Helena Storvall, 10/31/2013
- Re: [admin] segmentation fault, John Wise, 10/31/2013
- RE: [admin] segmentation fault, Helena Storvall, 10/31/2013
- Re: [admin] segmentation fault, Georgios Magklaras, 10/31/2013
Archive powered by MHonArc 2.6.16.